Research Specifications
- Sequence:
- LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
- CAS:
- 154947-66-7
- Molecular Weight:
- 4493.33 Da
- Vial:
- 10mg lyophilized
- Purity:
- ≥98% HPLC verified
LL-37 10mg
Human cathelicidin antimicrobial peptide LL-37
CAS: 154947-66-7
Broad
Spectrum
Bals 2000
37 aa
Length
hCAP18 C-terminus
Only 1
Human cathelicidin
CAMP gene
$89.99In Stock
Buy Now ≥98% Purity Verified Free Shipping $200+ HPLC Tested
Research Only
Research compound — no approved indications
Multiple Phase 1/2 trials in wound healing, diabetic ulcers, and inflammatory conditions. No current approvals for clinical use.
Also Known As
LL-37hCAP-18 C-terminusCAP-18CathelicidinCAMP peptideHuman cathelicidin antimicrobial peptide
Reconstitution & Dosing Guide
BAC Water
2mL
Final Concentration
5 mg/mL
Per Dose
Research doses vary widely by application and route
Gentle mixing — avoid vortexing to preserve α-helical structure
Often Stacked With
Published References
- 1.Bals R, Wang X, Zasloff M, Wilson JM. The peptide antibiotic LL-37/hCAP-18 is expressed in epithelia of the human lung where it has broad antimicrobial activity. Proc Natl Acad Sci USA (1998) PMID: 9736715
- 2.Vandamme D, Landuyt B, Luyten W, Schoofs L. A comprehensive summary of LL-37, the factotum human cathelicidin peptide. Cellular Immunology (2012) PMID: 23036015
Research Use Only. This product is intended for in-vitro laboratory research only. Not for human consumption, injection, or therapeutic use. Not medical advice. Always consult applicable regulations in your jurisdiction.
Price Comparison
| Supplier | Purity | Price | Shipping |
|---|---|---|---|
| our verified supplier | >98% HPLC | $89.99 | Free over $200 |
| Generic Research Suppliers | Varies (often <95%) | Similar–Higher | Varies |
| Pharmaceutical (Rx only) | Pharmaceutical grade | Not available for research | Rx required |
Buy Peptides Compounds
ARA-290 10mg
$80.99Buy Now
Abaloparatide 3mg
$134.99Buy Now
Cartalax 20mg
$71.99Buy Now
Glutathione 1500mg
$161.99Buy Now
LL-37 10mg
$89.99