CJC-1295 with DAC 10mg
GHRH analog with Drug Affinity Complex modification
CAS: 863288-34-0
~8 days
Plasma half-life
Teichman et al., 2006
2–3×
IGF-1 increase
Phase 1 trial
1/week
Dosing interval
Research protocol
Receptor Targets
Technical Data & References
Chemistry, identifiers, and primary literature for CJC-1295 No-DAC (Modified GRF 1-29) — available as lyophilized powder on Clav Tides.
- Short Sequence
- YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 (D-Ala², Gln⁸, Ala¹⁵, Leu²⁷)
- Full Sequence
- Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
- Salt Form
- Acetate
- # Amino Acids
- 29
- Purity
- ≥98%
- Molecular Formula
- C152H252N44O42
- Molecular Weight
- 3367.93 g/mol
- CAS Number
- 863288-34-0
- PubChem CID
- 16130957
- Source
- Synthetic (modified GHRH 1-29)
- Appearance
- Lyophilized powder
- Availability
- Lyophilized powder — Clav Tides
Primary Literature
- 1.
Teichman SL, Neale A, Lawrence B, Gagnon C, Castaigne JP, Frohman LA. Prolonged stimulation of growth hormone (GH) and insulin-like growth factor I secretion by CJC-1295, a long-acting analog of GH-releasing hormone, in healthy adults. J Clin Endocrinol Metab. 2006 Mar;91(3):799-805.
- 2.
Ionescu M, Frohman LA. Pulsatile secretion of growth hormone (GH) persists during continuous stimulation by CJC-1295, a long-acting GH-releasing hormone analog. J Clin Endocrinol Metab. 2006 Dec;91(12):4792-7.
Research use only. Data compiled from published literature and regulatory registries. CJC-1295 with DAC 10mg is supplied for in-vitro laboratory research — not for human consumption, injection, or therapeutic use.
Reconstitution & Dosing Guide
BAC Water
2mL
Final Concentration
5 mg/mL
Per Dose
1 mg = 20 IU on a U-100 syringe (0.2 mL)
Weekly dosing — a 10mg vial covers ~10 weeks at 1 mg/week
Often Stacked With
Published References
- 1.Teichman SL, Neale A, Lawrence B, et al.. Prolonged stimulation of growth hormone and IGF-I secretion by CJC-1295. J Clin Endocrinol Metab (2006) PMID: 16352683
Research Use Only. This product is intended for in-vitro laboratory research only. Not for human consumption, injection, or therapeutic use. Not medical advice. Always consult applicable regulations in your jurisdiction.
Price Comparison
| Supplier | Purity | Price | Shipping |
|---|---|---|---|
| our verified supplier | >98% HPLC | $89.99 | Free over $200 |
| Generic Research Suppliers | Varies (often <95%) | Similar–Higher | Varies |
| Pharmaceutical (Rx only) | Pharmaceutical grade | Not available for research | Rx required |
Buy Peptides Compounds
CJC-1295 with DAC 10mg
$89.99