Research Specifications
- Sequence:
- HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
- CAS:
- 40077-57-4
- Molecular Weight:
- 3326 Da
- Vial:
- 10mg lyophilized
- Purity:
- ≥98% HPLC verified
- Storage:
- −20°C long-term / 2–8°C up to 2 weeks reconstituted
VIP 10mg
Vasoactive Intestinal Peptide (28 amino acids)
CAS: 40077-57-4
28 aa
Peptide length
Secretin/glucagon superfamily
~2 min
Plasma half-life
Rapid degradation
Broad
Tissue distribution
CNS/ANS/GI/immune
Receptor Targets
Phase 2 trials (various indications)
Aviptadil (synthetic VIP) has reached Phase 2/3 for pulmonary indications (ARDS) with mixed results. No VIP product currently approved in US; some regional approvals for ED indications.
Also Known As
Reconstitution & Dosing Guide
BAC Water
2mL
Final Concentration
5 mg/mL
Per Dose
100 mcg = 0.02 mL (2 IU) · 500 mcg = 0.1 mL
Short half-life — use soon after reconstitution; stability ~2 weeks at 2–8°C
Often Stacked With
Published References
- 1.Said SI, Mutt V. Polypeptide with broad biological activity: isolation from small intestine. Science (1970) PMID: 5411969
- 2.Delgado M, Ganea D. Vasoactive intestinal peptide: a neuropeptide with pleiotropic immune functions. Amino Acids (2013) PMID: 21984310
Research Use Only. This product is intended for in-vitro laboratory research only. Not for human consumption, injection, or therapeutic use. Not medical advice. Always consult applicable regulations in your jurisdiction.
Price Comparison
| Supplier | Purity | Price | Shipping |
|---|---|---|---|
| our verified supplier | >98% HPLC | $125.99 | Free over $200 |
| Generic Research Suppliers | Varies (often <95%) | Similar–Higher | Varies |
| Pharmaceutical (Rx only) | Pharmaceutical grade | Not available for research | Rx required |
Buy Peptides Compounds
ACE-031 1mg
AICAR 50mg
ARA-290 10mg
Abaloparatide 3mg
VIP 10mg
$125.99